HADHB purified MaxPab rabbit polyclonal antibody (D01P)
  • HADHB purified MaxPab rabbit polyclonal antibody (D01P)

HADHB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003032-D01P
HADHB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HADHB protein.
Información adicional
Size 100 ug
Gene Name HADHB
Gene Alias ECHB|MGC87480|MSTP029|TP-BETA
Gene Description hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce
Immunogen Prot. Seq MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HADHB (NP_000174.1, 1 a.a. ~ 474 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3032

Enviar un mensaje


HADHB purified MaxPab rabbit polyclonal antibody (D01P)

HADHB purified MaxPab rabbit polyclonal antibody (D01P)