H3F3B monoclonal antibody (M01), clone 2D7-H1
  • H3F3B monoclonal antibody (M01), clone 2D7-H1

H3F3B monoclonal antibody (M01), clone 2D7-H1

Ref: AB-H00003021-M01
H3F3B monoclonal antibody (M01), clone 2D7-H1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant H3F3B.
Información adicional
Size 100 ug
Gene Name H3F3B
Gene Alias H3.3B|H3F3A
Gene Description H3 histone, family 3B (H3.3B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3021
Clone Number 2D7-H1
Iso type IgG1 kappa

Enviar un mensaje


H3F3B monoclonal antibody (M01), clone 2D7-H1

H3F3B monoclonal antibody (M01), clone 2D7-H1