H3F3B polyclonal antibody (A01)
  • H3F3B polyclonal antibody (A01)

H3F3B polyclonal antibody (A01)

Ref: AB-H00003021-A01
H3F3B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant H3F3B.
Información adicional
Size 50 uL
Gene Name H3F3B
Gene Alias H3.3B|H3F3A
Gene Description H3 histone, family 3B (H3.3B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen H3F3B (AAH17558, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3021

Enviar un mensaje


H3F3B polyclonal antibody (A01)

H3F3B polyclonal antibody (A01)