H1F0 purified MaxPab mouse polyclonal antibody (B01P)
  • H1F0 purified MaxPab mouse polyclonal antibody (B01P)

H1F0 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003005-B01P
H1F0 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human H1F0 protein.
Información adicional
Size 50 ug
Gene Name H1F0
Gene Alias H10|H1FV|MGC5241
Gene Description H1 histone family, member 0
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen H1F0 (AAH00145, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3005

Enviar un mensaje


H1F0 purified MaxPab mouse polyclonal antibody (B01P)

H1F0 purified MaxPab mouse polyclonal antibody (B01P)