GZMA monoclonal antibody (M01), clone 4C6
  • GZMA monoclonal antibody (M01), clone 4C6

GZMA monoclonal antibody (M01), clone 4C6

Ref: AB-H00003001-M01
GZMA monoclonal antibody (M01), clone 4C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GZMA.
Información adicional
Size 100 ug
Gene Name GZMA
Gene Alias CTLA3|HFSP
Gene Description granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GZMA (NP_006135.1, 41 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3001
Clone Number 4C6
Iso type IgG2a Kappa

Enviar un mensaje


GZMA monoclonal antibody (M01), clone 4C6

GZMA monoclonal antibody (M01), clone 4C6