Ver mas grande
GZMH MaxPab mouse polyclonal antibody (B01)
AB-H00002999-B01
Producto nuevo
GZMH MaxPab mouse polyclonal antibody (B01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | GZMH |
| Gene Alias | CCP-X|CGL-2|CSP-C|CTLA1|CTSGL2 |
| Gene Description | granzyme H (cathepsin G-like 2, protein h-CCPX) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GZMH (AAH27974, 1 a.a. ~ 246 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 2999 |
Más información
Mouse polyclonal antibody raised against a full-length human GZMH protein.