GYPC purified MaxPab mouse polyclonal antibody (B01P)
  • GYPC purified MaxPab mouse polyclonal antibody (B01P)

GYPC purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002995-B01P
GYPC purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GYPC protein.
Información adicional
Size 50 ug
Gene Name GYPC
Gene Alias CD236|CD236R|GE|GPC|GYPD|MGC117309|MGC126191|MGC126192
Gene Description glycophorin C (Gerbich blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GYPC (NP_002092.1, 1 a.a. ~ 128 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2995

Enviar un mensaje


GYPC purified MaxPab mouse polyclonal antibody (B01P)

GYPC purified MaxPab mouse polyclonal antibody (B01P)