GYG1 monoclonal antibody (M08), clone 2C10
  • GYG1 monoclonal antibody (M08), clone 2C10

GYG1 monoclonal antibody (M08), clone 2C10

Ref: AB-H00002992-M08
GYG1 monoclonal antibody (M08), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GYG1.
Información adicional
Size 100 ug
Gene Name GYG1
Gene Alias GYG
Gene Description glycogenin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2992
Clone Number 2C10
Iso type IgG1 Kappa

Enviar un mensaje


GYG1 monoclonal antibody (M08), clone 2C10

GYG1 monoclonal antibody (M08), clone 2C10