GYG1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GYG1 purified MaxPab rabbit polyclonal antibody (D01P)

GYG1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002992-D01P
GYG1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GYG1 protein.
Información adicional
Size 100 ug
Gene Name GYG1
Gene Alias GYG
Gene Description glycogenin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GYG1 (AAH00033.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2992

Enviar un mensaje


GYG1 purified MaxPab rabbit polyclonal antibody (D01P)

GYG1 purified MaxPab rabbit polyclonal antibody (D01P)