GYG1 polyclonal antibody (A01)
  • GYG1 polyclonal antibody (A01)

GYG1 polyclonal antibody (A01)

Ref: AB-H00002992-A01
GYG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GYG1.
Información adicional
Size 50 uL
Gene Name GYG1
Gene Alias GYG
Gene Description glycogenin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2992

Enviar un mensaje


GYG1 polyclonal antibody (A01)

GYG1 polyclonal antibody (A01)