GUK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002987-D01P
GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GUK1 protein.
Información adicional
Size 100 ug
Gene Name GUK1
Gene Alias GMK
Gene Description guanylate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GUK1 (NP_000849.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2987

Enviar un mensaje


GUK1 purified MaxPab rabbit polyclonal antibody (D01P)

GUK1 purified MaxPab rabbit polyclonal antibody (D01P)