GUCY2C monoclonal antibody (M12), clone 3H1
  • GUCY2C monoclonal antibody (M12), clone 3H1

GUCY2C monoclonal antibody (M12), clone 3H1

Ref: AB-H00002984-M12
GUCY2C monoclonal antibody (M12), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GUCY2C.
Información adicional
Size 100 ug
Gene Name GUCY2C
Gene Alias GUC2C|STAR
Gene Description guanylate cyclase 2C (heat stable enterotoxin receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2984
Clone Number 3H1
Iso type IgG2b Kappa

Enviar un mensaje


GUCY2C monoclonal antibody (M12), clone 3H1

GUCY2C monoclonal antibody (M12), clone 3H1