GTF2H2 MaxPab rabbit polyclonal antibody (D01)
  • GTF2H2 MaxPab rabbit polyclonal antibody (D01)

GTF2H2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002966-D01
GTF2H2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GTF2H2 protein.
Información adicional
Size 100 uL
Gene Name GTF2H2
Gene Alias BTF2|BTF2P44|MGC102806|T-BTF2P44|TFIIH
Gene Description general transcription factor IIH, polypeptide 2, 44kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2966

Enviar un mensaje


GTF2H2 MaxPab rabbit polyclonal antibody (D01)

GTF2H2 MaxPab rabbit polyclonal antibody (D01)