GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)
  • GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)

GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002958-B02P
GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTF2A2 protein.
Información adicional
Size 50 ug
Gene Name GTF2A2
Gene Alias HsT18745|TF2A2|TFIIA
Gene Description general transcription factor IIA, 2, 12kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2A2 (NP_004483.1, 1 a.a. ~ 109 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2958

Enviar un mensaje


GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)

GTF2A2 purified MaxPab mouse polyclonal antibody (B02P)