GTF2A1 monoclonal antibody (M01), clone 2H5
  • GTF2A1 monoclonal antibody (M01), clone 2H5

GTF2A1 monoclonal antibody (M01), clone 2H5

Ref: AB-H00002957-M01
GTF2A1 monoclonal antibody (M01), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GTF2A1.
Información adicional
Size 100 ug
Gene Name GTF2A1
Gene Alias MGC129969|MGC129970|TF2A1|TFIIA
Gene Description general transcription factor IIA, 1, 19/37kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF2A1 (NP_056943, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2957
Clone Number 2H5
Iso type IgG1 Kappa

Enviar un mensaje


GTF2A1 monoclonal antibody (M01), clone 2H5

GTF2A1 monoclonal antibody (M01), clone 2H5