GSTZ1 MaxPab rabbit polyclonal antibody (D01)
  • GSTZ1 MaxPab rabbit polyclonal antibody (D01)

GSTZ1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002954-D01
GSTZ1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTZ1 protein.
Información adicional
Size 100 uL
Gene Name GSTZ1
Gene Alias GSTZ1-1|MAAI|MAI|MGC2029
Gene Description glutathione transferase zeta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTZ1 (NP_665877.1, 1 a.a. ~ 216 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2954

Enviar un mensaje


GSTZ1 MaxPab rabbit polyclonal antibody (D01)

GSTZ1 MaxPab rabbit polyclonal antibody (D01)