GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)

GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002953-D01P
GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTT2 protein.
Información adicional
Size 100 ug
Gene Name GSTT2
Gene Alias MGC182032
Gene Description glutathione S-transferase theta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTT2 (NP_000845.1, 1 a.a. ~ 244 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2953

Enviar un mensaje


GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)

GSTT2 purified MaxPab rabbit polyclonal antibody (D01P)