GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002948-D01P
GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTM4 protein.
Información adicional
Size 100 ug
Gene Name GSTM4
Gene Alias GSTM4-4|GTM4|MGC131945|MGC9247
Gene Description glutathione S-transferase mu 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTM4 (NP_000841.1, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2948

Enviar un mensaje


GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)

GSTM4 purified MaxPab rabbit polyclonal antibody (D01P)