GSTM4 polyclonal antibody (A01)
  • GSTM4 polyclonal antibody (A01)

GSTM4 polyclonal antibody (A01)

Ref: AB-H00002948-A01
GSTM4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSTM4.
Información adicional
Size 50 uL
Gene Name GSTM4
Gene Alias GSTM4-4|GTM4|MGC131945|MGC9247
Gene Description glutathione S-transferase mu 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTM4 (NP_000841, 109 a.a. ~ 218 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2948

Enviar un mensaje


GSTM4 polyclonal antibody (A01)

GSTM4 polyclonal antibody (A01)