GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002941-D01P
GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTA4 protein.
Información adicional
Size 100 ug
Gene Name GSTA4
Gene Alias DKFZp686D21185|GSTA4-4|GTA4
Gene Description glutathione S-transferase alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTA4 (NP_001503.1, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2941

Enviar un mensaje


GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA4 purified MaxPab rabbit polyclonal antibody (D01P)