GSTA4 polyclonal antibody (A01)
  • GSTA4 polyclonal antibody (A01)

GSTA4 polyclonal antibody (A01)

Ref: AB-H00002941-A01
GSTA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSTA4.
Información adicional
Size 50 uL
Gene Name GSTA4
Gene Alias DKFZp686D21185|GSTA4-4|GTA4
Gene Description glutathione S-transferase alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTA4 (NP_001503, 168 a.a. ~ 222 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2941

Enviar un mensaje


GSTA4 polyclonal antibody (A01)

GSTA4 polyclonal antibody (A01)