GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002940-D01P
GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTA3 protein.
Información adicional
Size 100 ug
Gene Name GSTA3
Gene Alias GSTA3-3|GTA3|MGC22232
Gene Description glutathione S-transferase alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTA3 (AAH20619.1, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2940

Enviar un mensaje


GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA3 purified MaxPab rabbit polyclonal antibody (D01P)