GSR monoclonal antibody (M01), clone 6B4
  • GSR monoclonal antibody (M01), clone 6B4

GSR monoclonal antibody (M01), clone 6B4

Ref: AB-H00002936-M01
GSR monoclonal antibody (M01), clone 6B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GSR.
Información adicional
Size 100 ug
Gene Name GSR
Gene Alias MGC78522
Gene Description glutathione reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSR (NP_000628, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2936
Clone Number 6B4
Iso type IgG2a Kappa

Enviar un mensaje


GSR monoclonal antibody (M01), clone 6B4

GSR monoclonal antibody (M01), clone 6B4