GSR purified MaxPab rabbit polyclonal antibody (D01P)
  • GSR purified MaxPab rabbit polyclonal antibody (D01P)

GSR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002936-D01P
GSR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSR protein.
Información adicional
Size 100 ug
Gene Name GSR
Gene Alias MGC78522
Gene Description glutathione reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSR (NP_000628.2, 1 a.a. ~ 522 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2936

Enviar un mensaje


GSR purified MaxPab rabbit polyclonal antibody (D01P)

GSR purified MaxPab rabbit polyclonal antibody (D01P)