GSPT1 polyclonal antibody (A01)
  • GSPT1 polyclonal antibody (A01)

GSPT1 polyclonal antibody (A01)

Ref: AB-H00002935-A01
GSPT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSPT1.
Información adicional
Size 50 uL
Gene Name GSPT1
Gene Alias 551G9.2|ETF3A|FLJ38048|FLJ39067|GST1|eRF3a
Gene Description G1 to S phase transition 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSPT1 (NP_002085, 390 a.a. ~ 499 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2935

Enviar un mensaje


GSPT1 polyclonal antibody (A01)

GSPT1 polyclonal antibody (A01)