GRM8 polyclonal antibody (A01)
  • GRM8 polyclonal antibody (A01)

GRM8 polyclonal antibody (A01)

Ref: AB-H00002918-A01
GRM8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRM8.
Información adicional
Size 50 uL
Gene Name GRM8
Gene Alias FLJ41058|GLUR8|GPRC1H|MGC126724|MGLUR8|mGlu8
Gene Description glutamate receptor, metabotropic 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM8 (NP_000836, 486 a.a. ~ 575 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2918

Enviar un mensaje


GRM8 polyclonal antibody (A01)

GRM8 polyclonal antibody (A01)