GRM6 monoclonal antibody (M01), clone 1A11
  • GRM6 monoclonal antibody (M01), clone 1A11

GRM6 monoclonal antibody (M01), clone 1A11

Ref: AB-H00002916-M01
GRM6 monoclonal antibody (M01), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRM6.
Información adicional
Size 100 ug
Gene Name GRM6
Gene Alias CSNB1B|DKFZp686H1993|GPRC1F|MGLUR6|mGlu6
Gene Description glutamate receptor, metabotropic 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq ATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTCEACPGDMRPTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM6 (NP_000834, 477 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2916
Clone Number 1A11
Iso type IgG1 Kappa

Enviar un mensaje


GRM6 monoclonal antibody (M01), clone 1A11

GRM6 monoclonal antibody (M01), clone 1A11