GRM5 monoclonal antibody (M01), clone 1B3
  • GRM5 monoclonal antibody (M01), clone 1B3

GRM5 monoclonal antibody (M01), clone 1B3

Ref: AB-H00002915-M01
GRM5 monoclonal antibody (M01), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRM5.
Información adicional
Size 100 ug
Gene Name GRM5
Gene Alias GPRC1E|MGLUR5|mGlu5
Gene Description glutamate receptor, metabotropic 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq CPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM5 (NP_000833, 419 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2915
Clone Number 1B3
Iso type IgG2a Kappa

Enviar un mensaje


GRM5 monoclonal antibody (M01), clone 1B3

GRM5 monoclonal antibody (M01), clone 1B3