GRM2 polyclonal antibody (A01)
  • GRM2 polyclonal antibody (A01)

GRM2 polyclonal antibody (A01)

Ref: AB-H00002912-A01
GRM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRM2.
Información adicional
Size 50 uL
Gene Name GRM2
Gene Alias GLUR2|GPRC1B|MGLUR2|mGlu2
Gene Description glutamate receptor, metabotropic 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM2 (NP_000830, 414 a.a. ~ 506 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2912

Enviar un mensaje


GRM2 polyclonal antibody (A01)

GRM2 polyclonal antibody (A01)