GRLF1 monoclonal antibody (M01), clone 4D4-F8
  • GRLF1 monoclonal antibody (M01), clone 4D4-F8

GRLF1 monoclonal antibody (M01), clone 4D4-F8

Ref: AB-H00002909-M01
GRLF1 monoclonal antibody (M01), clone 4D4-F8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GRLF1.
Información adicional
Size 100 ug
Gene Name GRLF1
Gene Alias GRF-1|KIAA1722|MGC10745|P190-A|P190A|p190RhoGAP
Gene Description glucocorticoid receptor DNA binding factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRLF1 (AAH03514, 1 a.a. ~ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2909
Clone Number 4D4-F8
Iso type IgG2a kappa

Enviar un mensaje


GRLF1 monoclonal antibody (M01), clone 4D4-F8

GRLF1 monoclonal antibody (M01), clone 4D4-F8