GRIK4 polyclonal antibody (A01)
  • GRIK4 polyclonal antibody (A01)

GRIK4 polyclonal antibody (A01)

Ref: AB-H00002900-A01
GRIK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIK4.
Información adicional
Size 50 uL
Gene Name GRIK4
Gene Alias EAA1|GRIK|KA1
Gene Description glutamate receptor, ionotropic, kainate 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIK4 (NP_055434, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2900

Enviar un mensaje


GRIK4 polyclonal antibody (A01)

GRIK4 polyclonal antibody (A01)