GRIK3 polyclonal antibody (A01)
  • GRIK3 polyclonal antibody (A01)

GRIK3 polyclonal antibody (A01)

Ref: AB-H00002899-A01
GRIK3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIK3.
Información adicional
Size 50 uL
Gene Name GRIK3
Gene Alias EAA5|GLR7|GLUR7|GluR7a
Gene Description glutamate receptor, ionotropic, kainate 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NLYPDYASLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIK3 (NP_000822, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2899

Enviar un mensaje


GRIK3 polyclonal antibody (A01)

GRIK3 polyclonal antibody (A01)