GRIA1 monoclonal antibody (M01), clone 1G10
  • GRIA1 monoclonal antibody (M01), clone 1G10

GRIA1 monoclonal antibody (M01), clone 1G10

Ref: AB-H00002890-M01
GRIA1 monoclonal antibody (M01), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRIA1.
Información adicional
Size 100 ug
Gene Name GRIA1
Gene Alias GLUH1|GLUR1|GLURA|HBGR1|MGC133252
Gene Description glutamate receptor, ionotropic, AMPA 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIA1 (NP_000818, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2890
Clone Number 1G10
Iso type IgG2a Kappa

Enviar un mensaje


GRIA1 monoclonal antibody (M01), clone 1G10

GRIA1 monoclonal antibody (M01), clone 1G10