GRIA1 polyclonal antibody (A01)
  • GRIA1 polyclonal antibody (A01)

GRIA1 polyclonal antibody (A01)

Ref: AB-H00002890-A01
GRIA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIA1.
Información adicional
Size 50 uL
Gene Name GRIA1
Gene Alias GLUH1|GLUR1|GLURA|HBGR1|MGC133252
Gene Description glutamate receptor, ionotropic, AMPA 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIA1 (NP_000818, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2890

Enviar un mensaje


GRIA1 polyclonal antibody (A01)

GRIA1 polyclonal antibody (A01)