RAPGEF1 monoclonal antibody (M01), clone 3D10
  • RAPGEF1 monoclonal antibody (M01), clone 3D10

RAPGEF1 monoclonal antibody (M01), clone 3D10

Ref: AB-H00002889-M01
RAPGEF1 monoclonal antibody (M01), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAPGEF1.
Información adicional
Size 100 ug
Gene Name RAPGEF1
Gene Alias C3G|DKFZp781P1719|GRF2
Gene Description Rap guanine nucleotide exchange factor (GEF) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPGEF1 (AAH41710, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2889
Clone Number 3D10
Iso type IgG2a Kappa

Enviar un mensaje


RAPGEF1 monoclonal antibody (M01), clone 3D10

RAPGEF1 monoclonal antibody (M01), clone 3D10