RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)
  • RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)

RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002889-B01P
RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAPGEF1 protein.
Información adicional
Size 50 ug
Gene Name RAPGEF1
Gene Alias C3G|DKFZp781P1719|GRF2
Gene Description Rap guanine nucleotide exchange factor (GEF) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASKPDGPAELPLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAPGEF1 (NP_941372.1, 1 a.a. ~ 1095 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2889

Enviar un mensaje


RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)

RAPGEF1 purified MaxPab mouse polyclonal antibody (B01P)