GRB10 purified MaxPab rabbit polyclonal antibody (D01P)
  • GRB10 purified MaxPab rabbit polyclonal antibody (D01P)

GRB10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002887-D01P
GRB10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GRB10 protein.
Información adicional
Size 100 ug
Gene Name GRB10
Gene Alias GRB-IR|Grb-10|IRBP|KIAA0207|MEG1|RSS
Gene Description growth factor receptor-bound protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GRB10 (NP_001001550.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2887

Enviar un mensaje


GRB10 purified MaxPab rabbit polyclonal antibody (D01P)

GRB10 purified MaxPab rabbit polyclonal antibody (D01P)