GRB10 polyclonal antibody (A01)
  • GRB10 polyclonal antibody (A01)

GRB10 polyclonal antibody (A01)

Ref: AB-H00002887-A01
GRB10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRB10.
Información adicional
Size 50 uL
Gene Name GRB10
Gene Alias GRB-IR|Grb-10|IRBP|KIAA0207|MEG1|RSS
Gene Description growth factor receptor-bound protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2887

Enviar un mensaje


GRB10 polyclonal antibody (A01)

GRB10 polyclonal antibody (A01)