GPT purified MaxPab rabbit polyclonal antibody (D01P)
  • GPT purified MaxPab rabbit polyclonal antibody (D01P)

GPT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002875-D01P
GPT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GPT protein.
Información adicional
Size 100 ug
Gene Name GPT
Gene Alias AAT1|ALT1|GPT1
Gene Description glutamic-pyruvate transaminase (alanine aminotransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPT (NP_005300.1, 1 a.a. ~ 496 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2875

Enviar un mensaje


GPT purified MaxPab rabbit polyclonal antibody (D01P)

GPT purified MaxPab rabbit polyclonal antibody (D01P)