GPS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GPS2 purified MaxPab rabbit polyclonal antibody (D01P)

GPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002874-D01P
GPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GPS2 protein.
Información adicional
Size 100 ug
Gene Name GPS2
Gene Alias AMF-1|MGC104294|MGC119287|MGC119288|MGC119289
Gene Description G protein pathway suppressor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPS2 (NP_004480.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2874

Enviar un mensaje


GPS2 purified MaxPab rabbit polyclonal antibody (D01P)

GPS2 purified MaxPab rabbit polyclonal antibody (D01P)