GPS1 monoclonal antibody (M01), clone 1E8
  • GPS1 monoclonal antibody (M01), clone 1E8

GPS1 monoclonal antibody (M01), clone 1E8

Ref: AB-H00002873-M01
GPS1 monoclonal antibody (M01), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPS1.
Información adicional
Size 100 ug
Gene Name GPS1
Gene Alias COPS1|CSN1|MGC71287
Gene Description G protein pathway suppressor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPS1 (AAH00155, 390 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2873
Clone Number 1E8
Iso type IgG2b kappa

Enviar un mensaje


GPS1 monoclonal antibody (M01), clone 1E8

GPS1 monoclonal antibody (M01), clone 1E8