GPS1 purified MaxPab mouse polyclonal antibody (B01P)
  • GPS1 purified MaxPab mouse polyclonal antibody (B01P)

GPS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002873-B01P
GPS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPS1 protein.
Información adicional
Size 50 ug
Gene Name GPS1
Gene Alias COPS1|CSN1|MGC71287
Gene Description G protein pathway suppressor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYEGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPS1 (NP_997657.1, 1 a.a. ~ 527 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2873

Enviar un mensaje


GPS1 purified MaxPab mouse polyclonal antibody (B01P)

GPS1 purified MaxPab mouse polyclonal antibody (B01P)