MKNK2 polyclonal antibody (A02)
  • MKNK2 polyclonal antibody (A02)

MKNK2 polyclonal antibody (A02)

Ref: AB-H00002872-A02
MKNK2 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MKNK2.
Información adicional
Size 50 uL
Gene Name MKNK2
Gene Alias GPRK7|MNK2
Gene Description MAP kinase interacting serine/threonine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRWDSHFLLPPHPCRIHVRPGGLVRTVTVNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MKNK2 (AAH18345, 41 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2872

Enviar un mensaje


MKNK2 polyclonal antibody (A02)

MKNK2 polyclonal antibody (A02)