GRK4 monoclonal antibody (M07), clone 2C5
  • GRK4 monoclonal antibody (M07), clone 2C5

GRK4 monoclonal antibody (M07), clone 2C5

Ref: AB-H00002868-M07
GRK4 monoclonal antibody (M07), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRK4.
Información adicional
Size 100 ug
Gene Name GRK4
Gene Alias GPRK2L|GPRK4|GRK4a|IT11
Gene Description G protein-coupled receptor kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2868
Clone Number 2C5
Iso type IgG1 Kappa

Enviar un mensaje


GRK4 monoclonal antibody (M07), clone 2C5

GRK4 monoclonal antibody (M07), clone 2C5