CXCR3 monoclonal antibody (M01), clone 1C5
  • CXCR3 monoclonal antibody (M01), clone 1C5

CXCR3 monoclonal antibody (M01), clone 1C5

Ref: AB-H00002833-M01
CXCR3 monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CXCR3.
Información adicional
Size 100 ug
Gene Name CXCR3
Gene Alias CD182|CD183|CKR-L2|CMKAR3|GPR9|IP10-R|Mig-R|MigR
Gene Description chemokine (C-X-C motif) receptor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCR3 (NP_001495.1, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2833
Clone Number 1C5
Iso type IgM Kappa

Enviar un mensaje


CXCR3 monoclonal antibody (M01), clone 1C5

CXCR3 monoclonal antibody (M01), clone 1C5