GPC1 polyclonal antibody (A01)
  • GPC1 polyclonal antibody (A01)

GPC1 polyclonal antibody (A01)

Ref: AB-H00002817-A01
GPC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GPC1.
Información adicional
Size 50 uL
Gene Name GPC1
Gene Alias FLJ38078|glypican
Gene Description glypican 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPC1 (NP_002072, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2817

Enviar un mensaje


GPC1 polyclonal antibody (A01)

GPC1 polyclonal antibody (A01)