GP1BA monoclonal antibody (M03), clone 2E5
  • GP1BA monoclonal antibody (M03), clone 2E5

GP1BA monoclonal antibody (M03), clone 2E5

Ref: AB-H00002811-M03
GP1BA monoclonal antibody (M03), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GP1BA.
Información adicional
Size 100 ug
Gene Name GP1BA
Gene Alias BSS|CD42B|CD42b-alpha|GP1B|MGC34595
Gene Description glycoprotein Ib (platelet), alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GP1BA (AAH27955, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2811
Clone Number 2E5
Iso type IgG2a Kappa

Enviar un mensaje


GP1BA monoclonal antibody (M03), clone 2E5

GP1BA monoclonal antibody (M03), clone 2E5