Ver mas grande
GOT2 polyclonal antibody (A01)
AB-H00002806-A01
Producto nuevo
GOT2 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | GOT2 |
| Gene Alias | FLJ40994|KAT4|KATIV|mitAAT |
| Gene Description | glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 2806 |
Más información
Mouse polyclonal antibody raised against a partial recombinant GOT2.