GOT1 MaxPab rabbit polyclonal antibody (D01)
  • GOT1 MaxPab rabbit polyclonal antibody (D01)

GOT1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002805-D01
GOT1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GOT1 protein.
Información adicional
Size 100 uL
Gene Name GOT1
Gene Alias GIG18
Gene Description glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IHC-P,IP
Immunogen Prot. Seq MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GOT1 (NP_002070.1, 1 a.a. ~ 413 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2805

Enviar un mensaje


GOT1 MaxPab rabbit polyclonal antibody (D01)

GOT1 MaxPab rabbit polyclonal antibody (D01)