GOLGA2 monoclonal antibody (M01), clone 2C6
  • GOLGA2 monoclonal antibody (M01), clone 2C6

GOLGA2 monoclonal antibody (M01), clone 2C6

Ref: AB-H00002801-M01
GOLGA2 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GOLGA2.
Información adicional
Size 100 ug
Gene Name GOLGA2
Gene Alias GM130|MGC20672
Gene Description golgi autoantigen, golgin subfamily a, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GOLGA2 (AAH06381.1, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2801
Clone Number 2C6
Iso type IgG1 Kappa

Enviar un mensaje


GOLGA2 monoclonal antibody (M01), clone 2C6

GOLGA2 monoclonal antibody (M01), clone 2C6